Gene Cg7g009800.1


Sequence ID Cg7g009800.1  add to my list
Species Citrus maxima
Alias No gene alias
Length 88aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 88 amino acids

>Cg7g009800.1_CITMA
MSQTVVLKVGMSCEGCVGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTVSKT
GKKTAFWEEEKPAPAESDSKPTEAVAAA





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cg7g009800.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HanXRQChr07g0194221 orthology 0.716 2 - -
HanXRQChr08g0217841 orthology 0.326 2 - -
HanXRQChr11g0322281 orthology 0.618 2 - -
HanXRQChr12g0368131 orthology 0.326 2 126.3 1.5e-29
PGSC0003DMP400040663 orthology 0.221 5 131.3 3.1e-31
Solyc05g055310.2.1 orthology 0.221 5 131.3 3.1e-31
capan_pan_p024732 orthology 0.278 4 - -
orange1.1t01168.1 orthology 0.0307 1 169.5 1e-42