Gene Cg7g009800.1
| Sequence ID | Cg7g009800.1 add to my list | ||
|---|---|---|---|
| Species | Citrus maxima | ||
| Alias | No gene alias | ||
| Length | 88aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 88 amino acids
>Cg7g009800.1_CITMA MSQTVVLKVGMSCEGCVGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTVSKT GKKTAFWEEEKPAPAESDSKPTEAVAAA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP239638 | Unannotated cluster |
| 3 | GP341755 | Unannotated cluster |
| 4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg7g009800.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HanXRQChr07g0194221 | orthology | 0.716 | 2 | - | - |
| HanXRQChr08g0217841 | orthology | 0.326 | 2 | - | - |
| HanXRQChr11g0322281 | orthology | 0.618 | 2 | - | - |
| HanXRQChr12g0368131 | orthology | 0.326 | 2 | 126.3 | 1.5e-29 |
| PGSC0003DMP400040663 | orthology | 0.221 | 5 | 131.3 | 3.1e-31 |
| Solyc05g055310.2.1 | orthology | 0.221 | 5 | 131.3 | 3.1e-31 |
| capan_pan_p024732 | orthology | 0.278 | 4 | - | - |
| orange1.1t01168.1 | orthology | 0.0307 | 1 | 169.5 | 1e-42 |