Gene Cg7g010440.1
Sequence ID | Cg7g010440.1 add to my list | ||
---|---|---|---|
Species | Citrus maxima | ||
Alias | No gene alias | ||
Length | 350aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 350 amino acids
>Cg7g010440.1_CITMA MGEEEKKPPAAEEKKPEEAKKEEAKKEEAAEKPQEKPAAAEEKKPAPEESKDAKAAKEEQ SPPPPKEIVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDR VQRKSHRQVELLSPIPKPPAAEEEKKAEEKAPPKPEEKKEEPQVIIVVLKVHMHCEGCSL EIKKRILRMEGVESAEPDLKNSQVTVKGVFDPPKLVDYVYKRTGKHAVIVKQEPEKKEEK GGGGDGGGGDGAANKEEKKGGGGGENKENKAAAGEQENQEKKEGDNKKSNDDEAKAAAAD ATAATEETTVVELKKNINEYYYYPQRYAMEMYAYPPQIFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg7g010440.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cm018610.1 | orthology | 0.0029 | 1 | 271.2 | 1.5e-72 |
FvH4_5g08650.1 | orthology | 0.371 | 6 | 225.7 | 4.4e-59 |
Manes.06G121400.1 | orthology | 0.249 | 3 | 234.2 | 1.4e-61 |
Manes.14G049200.1 | orthology | 0.264 | 3 | - | - |
maldo_pan_p003643 | orthology | 0.39 | 6 | 254 | 2.71e-82 |
maldo_pan_p029843 | orthology | 0.391 | 6 | - | - |
orange1.1t02606.2 | orthology | 0.0082 | 2 | 271.2 | 9.6e-73 |
thecc_pan_p013659 | orthology | 0.324 | 4 | 247 | 1.04e-79 |
vitvi_pan_p029254 | orthology | 0.386 | 6 | 251 | 1.26e-81 |