Gene Cg7g011400.1
| Sequence ID | Cg7g011400.1 add to my list | ||
|---|---|---|---|
| Species | Citrus maxima | ||
| Alias | No gene alias | ||
| Length | 210aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 210 amino acids
>Cg7g011400.1_CITMA MFEMRILTANAALVFLLGSKLKILAANAGLGLMCMNIFVLYNCGKLAILPSFECLIVEMR VHMDCAGCETKIKKALKKLDGVDDVDIDMAMQKVTVMGWADQKKVLKTVRKTGRRAELWP YPYNPEYQNFTQHYYYKQQQQQQQRQHHHHSQIPIAYNYMFQQPSSSYNYEKHGYSGDFG YYQQAPYSHIFDERTGAMFSDENPHACTVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg7g011400.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cm129650.1 | orthology | 0.0254 | 1 | 263.1 | 2.4e-70 |
| FvH4_3g07830.1 | orthology | 0.745 | 6 | 147.5 | 9.3e-36 |
| Manes.17G055500.1 | orthology | 0.338 | 2 | 202.2 | 3.6e-52 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_31664.1 | orthology | 0.508 | 5 | 183.7 | 1.3e-46 |
| cicar_pan_p021456 | orthology | 0.626 | 5 | 167 | 1.81e-53 |
| maldo_pan_p003465 | orthology | 0.804 | 6 | - | - |
| maldo_pan_p053909 | orthology | 0.766 | 6 | 169 | 1.65e-53 |
| soybn_pan_p018217 | orthology | 0.47 | 4 | 192 | 4.7e-63 |
| thecc_pan_p000996 | orthology | 0.655 | 5 | - | - |