Gene Cg8g001620.1
| Sequence ID | Cg8g001620.1 add to my list | ||
|---|---|---|---|
| Species | Citrus maxima | ||
| Alias | No gene alias | ||
| Length | 154aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 154 amino acids
>Cg8g001620.1_CITMA MGVLDHFSDYFDCSHGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVE RKANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRR ADDPQVSQIARASSFEVRYTTAFSDENTQACAIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg8g001620.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cm237380.1 | orthology | 0.0199 | 2 | 306.2 | 1.8e-83 |
| Cs8g02620.1 | orthology | 0.0075 | 2 | 310.8 | 4.8e-85 |
| MELO3C013353.2.1 | orthology | 0.185 | 3 | 271.6 | 2.7e-73 |
| Manes.04G076000.1 | orthology | 0.113 | 3 | 288.5 | 2.8e-78 |
| cucsa_pan_p008172 | orthology | 0.179 | 3 | 262 | 1.33e-91 |