Gene Cg9g003840.1
| Sequence ID | Cg9g003840.1 add to my list | ||
|---|---|---|---|
| Species | Citrus maxima | ||
| Alias | No gene alias | ||
| Length | 144aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 144 amino acids
>Cg9g003840.1_CITMA MFDPTHIDWFERFALVVAEFKVSMYCNACERTVARAISKFKGVEKFTTDMNKHRVVVTGR IDPQKVLKKLKKKTGKKVEIVDNNNNNNEESPKGCSNNEENEDTYRALLDKTNEDLAILF DCCKYNDEVLMMFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP345758 | Unannotated cluster |
| 4 | GP467256 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg9g003840.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 1 | 8 | 82.4 | 2.5e-16 |
| Ca_27_985.2 | orthology | 1 | 9 | - | - |
| Ca_34_139.2 | orthology | 1 | 9 | - | - |
| Ca_43_446.2 | orthology | 1 | 8 | - | - |
| Cc03_g02440 | orthology | 1 | 8 | 76.3 | 1.6e-14 |
| Cm135610.1 | orthology | 0.0332 | 1 | 166.4 | 2.1e-41 |
| DCAR_030575 | orthology | 1 | 7 | 77 | 1.2e-14 |
| FvH4_3g29750.1 | orthology | 0.696 | 4 | 120.2 | 1.1e-27 |
| FvH4_4g16960.1 | orthology | 0.691 | 4 | - | - |
| HanXRQChr08g0226491 | orthology | 1 | 7 | 83.6 | 1.8e-16 |
| MELO3C021374.2.1 | orthology | 0.817 | 5 | 111.7 | 3.4e-25 |
| Manes.15G018700.1 | orthology | 0.852 | 6 | 107.1 | 1.1e-23 |
| Solyc03g098650.2.1 | orthology | 1 | 7 | 85.9 | 2.4e-17 |
| brana_pan_p026722 | orthology | 1 | 10 | 108 | 5.88e-31 |
| braol_pan_p034893 | orthology | 1 | 9 | 107 | 1.07e-30 |
| braol_pan_p054032 | orthology | 1 | 8 | - | - |
| brarr_pan_p010495 | orthology | 1 | 10 | 107 | 9.52e-31 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 0.692 | 4 | 110.5 | 9.8e-25 |
| cicar_pan_p022803 | orthology | 0.658 | 4 | 122 | 5.67e-37 |
| cucsa_pan_p017292 | orthology | 0.852 | 5 | 124 | 9.28e-38 |
| medtr_pan_p033077 | orthology | 0.696 | 4 | 127 | 7.63e-39 |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 0.761 | 5 | 104.4 | 6.3e-23 |
| soybn_pan_p008694 | orthology | 0.7 | 5 | 132 | 1.89e-40 |
| soybn_pan_p032351 | orthology | 0.734 | 5 | - | - |
| thecc_pan_p001371 | orthology | 0.652 | 5 | 137 | 9.23e-43 |
| vitvi_pan_p022438 | orthology | 0.902 | 5 | 113 | 4.01e-33 |
| vitvi_pan_p032656 | orthology | 0.892 | 5 | - | - |