Gene CgUng002450.1
Sequence ID | CgUng002450.1 add to my list | ||
---|---|---|---|
Species | Citrus maxima | ||
Alias | No gene alias | ||
Length | 117aa | ||
Gene Ontology |
![]()
|
Length: 117 amino acids
>CgUng002450.1_CITMA MHYCCMVMRINIDCNGCYRKVRRALLDMQELESHLIEKKMCRVSVSGNFIPQDLAIKIRK KTNRRVEILEIHDFSSNNNNIIEGHQEQLLQDQRPQNQMMGSWNLISKQNRCATYVT
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for CgUng002450.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv5_110870_wcqq.t1 | orthology | 1 | 8 | 109.8 | 1.1e-24 |
Bv5_110870_wcqq.t2 | orthology | 1 | 8 | - | - |
Cm118330.1 | orthology | 0.0226 | 2 | 233.8 | 8.9e-62 |
Cs7g26570.1 | orthology | 0 | 1 | 241.9 | 2.1e-64 |
FvH4_5g12320.1 | orthology | 0.735 | 4 | 131.7 | 2.9e-31 |
Manes.05G138100.1 | orthology | 0.609 | 5 | 108.6 | 3.1e-24 |
PGSC0003DMP400010112 | orthology | 1 | 7 | 111.3 | 4.4e-25 |
Solyc03g119630.2.1 | orthology | 1 | 8 | 112.1 | 2.6e-25 |
cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 0.878 | 6 | 126.3 | 1.4e-29 |
capan_pan_p000343 | orthology | 1 | 8 | - | - |
cicar_pan_p024669 | orthology | 1 | 7 | 121 | 5.64e-37 |
cucsa_pan_p010693 | orthology | 0.893 | 8 | 118 | 7.21e-36 |
maldo_pan_p026714 | orthology | 0.719 | 4 | 133 | 1.34e-41 |
medtr_pan_p036900 | orthology | 1 | 7 | 122 | 3.61e-37 |
phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 0.945 | 6 | 117.5 | 5.9e-27 |
soybn_pan_p040036 | orthology | 1 | 6 | - | - |
soybn_pan_p040183 | orthology | 0.819 | 6 | 127 | 1.82e-39 |
soybn_pan_p040952 | orthology | 0.795 | 6 | - | - |
soybn_pan_p042566 | orthology | 0.877 | 6 | - | - |
thecc_pan_p001600 | orthology | 0.769 | 7 | 146 | 3.01e-46 |
vitvi_pan_p014384 | orthology | 0.654 | 6 | - | - |