Gene Cm053250.1
| Sequence ID | Cm053250.1 add to my list | ||
|---|---|---|---|
| Species | Citrus medica | ||
| Alias | No gene alias | ||
| Length | 146aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 146 amino acids
>Cm053250.1_CITME MGVLDHLLDLFETIPRGKKRKPMQTVDIKVKMDCDGCERKVRNAVSSIRGAKSVEVNRKQ SRVTVTGYVDPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNVVQA LPSPNATDERLTTLFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cm053250.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg2g033970.1 | orthology | 0.0147 | 2 | 294.3 | 4.1e-80 |
| Cs2g13790.1 | orthology | 0.0078 | 1 | 295.8 | 1.5e-80 |
| MELO3C005315.2.1 | orthology | 0.545 | 6 | - | - |
| MELO3C012307.2.1 | orthology | 0.485 | 6 | 229.9 | 8.6e-61 |
| Manes.15G126400.1 | orthology | 0.27 | 4 | 250.8 | 6.2e-67 |
| Manes.17G075300.1 | orthology | 0.324 | 4 | - | - |
| cucsa_pan_p007548 | orthology | 0.538 | 6 | - | - |
| cucsa_pan_p020835 | orthology | 0.492 | 6 | 224 | 4.93e-77 |
| thecc_pan_p004875 | orthology | 0.236 | 3 | 244 | 7.35e-85 |