Gene Cm102380.1
Sequence ID | Cm102380.1 add to my list | ||
---|---|---|---|
Species | Citrus medica | ||
Alias | No gene alias | ||
Length | 187aa | ||
Gene Ontology |
![]()
|
Length: 187 amino acids
>Cm102380.1_CITME MCIYKLLPKSLVSSLSFEYFLSIRQMGEEAKQEQAKADTQPEPVAEEKKEEKAAEEEKKE EAKPPSPFVLFVDLHCVGCAKKIEKSIMRIRGVEGVTIDMAQNQVTIKGIVAPQAVCAKI MKKTKRRAKVLSPLPAAEGEPVPEVITSQVSGLTTVELNVNMHCEACADELKRKILKMRG IYIYIFF
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cm102380.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg5g019800.1 | orthology | 0.0377 | 1 | 255 | 3.5e-68 |
thecc_pan_p011248 | orthology | 0.257 | 2 | 214 | 7.56e-70 |