Gene Cm173610.1


Sequence ID Cm173610.1  add to my list
Species Citrus medica
Alias No gene alias
Length 241aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 241 amino acids

>Cm173610.1_CITME
MRCPEHSRSREAAPDRCLHLIDPTGRFSPRAAQSKGPLGLSHEGRRVPSRFFHVLLPSHK
SLAKSLKIAFLRITSGYSLFAVIMGFLEYVSELCDFESCWHSHRKLKKRKQLQTVEIKIK
MDCEGCERRVKKSVEGMKGVTQVEVDPKQSKLTVIGYVDPDKVLERVRHRTGKKAEFWPY
VPYDVVPHPYVPEAYDKKAPPGYVRNVLDDPVAAPLARASSFEVKYTTAFSDENPNACAV
M




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP502246 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cm173610.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT5G66110.1 orthology 0.436 7 232.6 2.5e-61
Cg1g001350.1 orthology 0.0372 2 313.9 8.2e-86
Cm280940.1 ultra-paralogy 0.0011 0 - -
Cs1g25820.1 orthology 0.0305 2 318.9 2.8e-87
MELO3C007926.2.1 orthology 0.379 7 250.4 1e-66
Manes.01G148900.1 orthology 0.391 5 241.1 8.1e-64
brana_pan_p030902 orthology 0.443 9 - -
braol_pan_p039277 orthology 0.434 8 - -
brarr_pan_p021369 orthology 0.443 9 - -
cucsa_pan_p018650 orthology 0.379 7 - -
maldo_pan_p003753 orthology 0.191 3 - -
medtr_pan_p005386 orthology 0.305 3 - -
thecc_pan_p011891 orthology 0.233 3 - -