Gene Cm280700.1
| Sequence ID | Cm280700.1 add to my list | ||
|---|---|---|---|
| Species | Citrus medica | ||
| Alias | No gene alias | ||
| Length | 136aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 136 amino acids
>Cm280700.1_CITME MGKLSLGKILDCLCISSPGSCSCFCLNTFEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQT LAFQLKPKMVVLRVSMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVTGDIIPFEVLE SVSKVKNAELWSASCY
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cm280700.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G24450.1 | orthology | 0.631 | 6 | - | - |
| Cg4g008380.1 | orthology | 0.0157 | 3 | - | - |
| Cm003330.1 | orthology | 0 | 1 | - | - |
| Cs4g16810.1 | orthology | 0.0152 | 2 | - | - |
| brana_pan_p019259 | orthology | 0.668 | 8 | - | - |
| braol_pan_p017790 | orthology | 0.668 | 8 | - | - |
| brarr_pan_p009295 | orthology | 0.655 | 7 | - | - |
| thecc_pan_p010057 | orthology | 0.212 | 5 | - | - |