Gene Cm280940.1


Sequence ID Cm280940.1  add to my list
Species Citrus medica
Alias No gene alias
Length 158aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 158 amino acids

>Cm280940.1_CITME
MGFLEYVSELCDFESCWHSHRKLKKRKQLQTVEIKIKMDCEGCERRVKKSVEGMKGVTQV
EVDPKQSKLTVIGYVDPDKVLERVRHRTGKKAEFWPYVPYDVVPHPYVPEAYDKKAPPGY
VRNVLDDPVAAPLARASSFEVKYTTAFSDENPNACAVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cm280940.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT5G66110.1 orthology 0.436 7 230 6.72e-79
Cg1g001350.1 orthology 0.0372 2 312 3.29e-111
Cm173610.1 ultra-paralogy 0.0011 0 - -
Cs1g25820.1 orthology 0.0305 2 317 3.73e-113
MELO3C007926.2.1 orthology 0.379 7 248 4.24e-86
Manes.01G148900.1 orthology 0.391 5 239 2.01e-82
brana_pan_p030902 orthology 0.443 9 210 3.29e-71
braol_pan_p039277 orthology 0.434 8 - -
brarr_pan_p021369 orthology 0.443 9 - -
cucsa_pan_p018650 orthology 0.379 7 248 3.98e-86
maldo_pan_p003753 orthology 0.191 3 229 1.37e-78
medtr_pan_p005386 orthology 0.305 3 256 5.21e-89
thecc_pan_p011891 orthology 0.233 3 270 8.96e-95