Gene Cs1g02630.1
Sequence ID | Cs1g02630.1 add to my list | ||
---|---|---|---|
Species | Citrus sinensis | ||
Alias | No gene alias | ||
Length | 231aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 231 amino acids
>Cs1g02630.1_CITSI MAAKNKDIGVITGVYNVNLHCPQCARKIEKRLLKIEGIQSVDADFEKAEIKVKGVIDVIK IHKLIQKTSQKKVELISPPLIKIKEIGAIKEIKEKEVILRTTTLKVHIHCAQCEHDLRKK LLKHKGIYSVNADTKAQTVTVQGTIESDRLLSYLRKKVHKHAEIVTSKQEKKEEIKKDNE KFEVKSTELSTKFVEFKEDVKSKESNVPYFIHYVYAPQLFSDENPNACSIL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs1g02630.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg5g044990.1 | orthology | 0.0087 | 1 | 441.8 | 2.5e-124 |
Cm175060.1 | orthology | 0.0254 | 2 | 427.9 | 6.3e-120 |
thecc_pan_p018185 | orthology | 0.376 | 3 | 268 | 3.33e-91 |