Gene Cs1g25820.1


Sequence ID Cs1g25820.1  add to my list
Species Citrus sinensis
Alias No gene alias
Length 158aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 158 amino acids

>Cs1g25820.1_CITSI
MGFLEYVSELCDFESRWHSHRKLKKRKQLQTVEIKIKMDCEGCERRVKKSVEGMKGVTQV
EVDPKQSKLTVIGYVDPDKVLERVRHRTGKKAEFWPYVPYDVVPRPYAPEAYDKKAPPGY
VRNVLDNPVAAPLARASSFEVKYTTAFSDENPNACAVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cs1g25820.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT5G66110.1 orthology 0.436 8 226.5 1.2e-59
Cg1g001350.1 orthology 0.0197 1 318.9 1.7e-87
Cm173610.1 orthology 0.0305 2 319.3 2.2e-87
Cm280940.1 orthology 0.0305 2 315 3.34e-112
MELO3C007926.2.1 orthology 0.378 8 252.3 1.7e-67
Manes.01G148900.1 orthology 0.391 6 238.8 2.6e-63
brana_pan_p030902 orthology 0.442 10 206 1.1e-69
braol_pan_p039277 orthology 0.434 9 - -
brarr_pan_p021369 orthology 0.442 10 - -
cucsa_pan_p018650 orthology 0.379 8 248 5.66e-86
maldo_pan_p003753 orthology 0.19 4 225 4.57e-77
medtr_pan_p005386 orthology 0.304 4 254 2.12e-88
thecc_pan_p011891 orthology 0.233 4 266 6.05e-93