Gene Cs2g14960.1
| Sequence ID | Cs2g14960.1 add to my list |
|---|---|
| Species | Citrus sinensis |
| Alias | No gene alias |
| Length | 166aa |
Length: 166 amino acids
>Cs2g14960.1_CITSI MPVTTNEKEKSKPECDKAKTSDSCGKETDKEKESKNGRNGNGDKAAKKEDKVKESAANSS IPEVIKNENPLPLQPEMNYNMYPKTLPEVGNIKTQTQYCYMVEPCPITVPYYAIPSYATH LLPPPTFYGQPHYCHERPVFQPMYQAPVTRVGDYFSDENTVGCSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP477063 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| DCAR_021816 | orthology | 1 | 4 | - | - |
| Manes.04G096100.1 | orthology | 0.589 | 3 | 107.5 | 9.7e-24 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_40153.1 | orthology | 0.913 | 4 | 84.3 | 8.7e-17 |
| soybn_pan_p004695 | orthology | 0.999 | 4 | - | - |
| soybn_pan_p009525 | orthology | 0.899 | 4 | 76.3 | 2.4e-17 |
| thecc_pan_p023830 | orthology | 0.721 | 1 | - | - |
| vitvi_pan_p003003 | orthology | 0.554 | 3 | 108 | 1.03e-29 |