GreenPhyl v5 - Gene Cs3g18690.1

Gene Cs3g18690.1

Sequence ID

Cs3g18690.1 ^{add to my list}

Species

Citrus sinensis

Alias

No gene alias

Length

150aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Homolog Predictions

150 amino acids

>Cs3g18690.1_CITSI
MGVEGTIEYISDLLSSVKKKKKKKQMQTVALKVRMDCDGCARKMKGVLSSVKGAKSVDVD
LKQQKVTVTGFVEPKKVLAAAKATKKKVEIWPYVPYNIVSNPYVSQAYDKKAPPNHVRAI
PATATVTESTMDDRYTNMFSDENPNACSIM

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP040065	Unannotated cluster
4	GP463617	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for Cs3g18690.1

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
AT4G08570.1	orthology	0.374	6	204.9	3.5e-53
Cg3g015470.1	orthology	0	1	274.2	4.5e-74
Cm020980.1	orthology	0.0131	2	270	1.4e-72
Manes.18G070700.1	orthology	0.208	4	241.5	3.9e-64
brana_pan_p007268	orthology	0.448	7	-	-
braol_pan_p017356	orthology	0.448	7	-	-
brarr_pan_p027720	orthology	0.4	6	191	9.43e-64
thecc_pan_p011528	orthology	0.205	3	241	1.38e-83