Gene Cs5g16230.1
| Sequence ID | Cs5g16230.1 add to my list | ||
|---|---|---|---|
| Species | Citrus sinensis | ||
| Alias | No gene alias | ||
| Length | 134aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 134 amino acids
>Cs5g16230.1_CITSI MANMQIVPACKNVEAQYVELMVPLYSHGCERKVKNTLTHLKGIYSVNVDYDQQKVIVWGI CNKYDVLETIRSKRKEARFWNQEGNLNDMMEKSPSSSPSHSNPPKNSKPYLILIRAQSFK WKALKKVFSRTSSF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP342521 | Unannotated cluster |
| 4 | GP077751 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs5g16230.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg5g019790.1 | orthology | 0.0074 | 1 | 274.2 | 4e-74 |
| Cm102390.1 | orthology | 0.0352 | 3 | 256.9 | 1.1e-68 |
| Cm320160.1 | orthology | 0.0352 | 3 | - | - |