Gene Cs6g10930.1
Sequence ID | Cs6g10930.1 add to my list | ||
---|---|---|---|
Species | Citrus sinensis | ||
Alias | No gene alias | ||
Length | 156aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 156 amino acids
>Cs6g10930.1_CITSI MFGWRLGKTQLPNAMAIVELMVHMDCEGCEKRIRRAISKIDGIFDFIITGVDSLDIDMDK QKVTVTGYVDERKVLKVVRRTGRKAEFWPFPYDSEYYPYASTYLDESTFRSSYNYYQHGF NESVHGYFPDQAYETVPDDTVHLFSEDNVHAYCTIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs6g10930.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G56891.1 | orthology | 0.752 | 8 | 160.2 | 1e-39 |
Ca_28_123.1 | orthology | 0.571 | 9 | - | - |
Ca_31_155.3 | orthology | 0.527 | 9 | - | - |
Ca_64_676.1 | orthology | 0.487 | 9 | - | - |
Ca_78_1273.1 | orthology | 0.527 | 9 | - | - |
Cc06_g21060 | orthology | 0.442 | 9 | 122.5 | 2.2e-28 |
Cg6g011520.1 | orthology | 0.0072 | 1 | 304.7 | 3.2e-83 |
DCAR_016949 | orthology | 0.588 | 9 | 140 | 5.9e-44 |
FvH4_2g26780.1 | orthology | 0.258 | 5 | 196.1 | 1.7e-50 |
MELO3C019416.2.1 | orthology | 0.302 | 5 | 173.7 | 7.8e-44 |
Manes.08G099200.1 | orthology | 0.25 | 5 | 189.9 | 1.4e-48 |
Oeu053981.1 | orthology | 0.508 | 10 | 165.2 | 5e-41 |
brana_pan_p032952 | orthology | 0.9 | 9 | - | - |
brana_pan_p033418 | orthology | 0.871 | 10 | 150 | 5.24e-47 |
brana_pan_p049288 | orthology | 0.899 | 8 | - | - |
braol_pan_p001934 | orthology | 0.905 | 9 | 149 | 9.86e-47 |
braol_pan_p038031 | orthology | 0.848 | 9 | - | - |
brarr_pan_p006813 | orthology | 0.871 | 10 | - | - |
brarr_pan_p018750 | orthology | 0.904 | 8 | 149 | 8.52e-47 |
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.294 | 5 | 196.4 | 1.5e-50 |
cucsa_pan_p011351 | orthology | 0.335 | 5 | 230 | 5.41e-79 |
ipotf_pan_p003030 | orthology | 0.668 | 11 | 187 | 8.08e-62 |
itb11g01700.t1 | orthology | 0.664 | 11 | 187.2 | 9.2e-48 |
maldo_pan_p024328 | orthology | 0.342 | 5 | - | - |
maldo_pan_p038662 | orthology | 0.248 | 5 | 191 | 2.66e-63 |
medtr_pan_p030129 | orthology | 0.245 | 3 | 190 | 1.15e-63 |
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 0.292 | 4 | 238 | 4e-63 |
soybn_pan_p020075 | orthology | 0.311 | 5 | 190 | 2.29e-63 |
thecc_pan_p019791 | orthology | 0.176 | 4 | 206 | 2.49e-69 |
vitvi_pan_p003255 | orthology | 0.299 | 7 | 171 | 1.44e-55 |