Gene Cs6g17860.1


Sequence ID Cs6g17860.1  add to my list
Species Citrus sinensis
Alias No gene alias
Length 146aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 146 amino acids

>Cs6g17860.1_CITSI
MGALDYLSNFCTVTSTRSKRKAMQTVEIKVKMDCDGCERRVKNAVNSMKGVKSVEVNRKQ
SRVTVSGYVEPNKVLKRVKSTGKRAEFWPYIPQHLVHYPYAPGAYDKRAPAGYVRNVVQA
FPATNAPEDNLVSIFSDDNVNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cs6g17860.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg6g018770.1 orthology 0 1 297 6.3e-81
Cm050050.1 orthology 0 1 297 1.1e-80
Manes.01G115000.1 orthology 0.156 3 - -
Manes.02G074200.1 orthology 0.139 3 271.2 4.4e-73
maldo_pan_p022588 orthology 0.106 2 259 1.33e-90
thecc_pan_p003496 orthology 0.114 4 266 2.53e-93