Gene Cs7g13150.1
Sequence ID | Cs7g13150.1 add to my list | ||
---|---|---|---|
Species | Citrus sinensis | ||
Alias | No gene alias | ||
Length | 204aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 204 amino acids
>Cs7g13150.1_CITSI MAAVSDDDDGVKNKELPGIEFKKSRRTKSLTGTSLASIESLSMPLVQEVVLSADIRCSEC QKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVVVEVSKRQITAILCMVMRINLDCNGC CRKLRRILLNMKEIEAHLIEKQQCRVSVCGRFRPSDVAIKIRKKMNRRVEILEIQEHNES NEPADQKPTNEQADQKPTNVICGC
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs7g13150.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G25855.1 | orthology | 0.993 | 6 | 106.3 | 2.3e-23 |
Cg7g014560.1 | orthology | 0.0016 | 2 | 342.4 | 1.8e-94 |
Cm038010.1 | orthology | 0.0011 | 1 | 344.4 | 8.1e-95 |
FvH4_4g27630.1 | orthology | 0.588 | 5 | 120.2 | 1.5e-27 |
Manes.06G070100.1 | orthology | 0.755 | 5 | - | - |
Manes.14G100500.1 | orthology | 0.678 | 5 | 115.2 | 5.7e-26 |
brana_pan_p048851 | orthology | 0.965 | 8 | 105 | 3.17e-29 |
brana_pan_p052252 | orthology | 0.957 | 6 | - | - |
brana_pan_p062585 | orthology | 0.976 | 6 | - | - |
braol_pan_p011410 | orthology | 0.957 | 6 | 106 | 9.34e-30 |
braol_pan_p038631 | orthology | 0.986 | 7 | - | - |
braol_pan_p053779 | orthology | 0.957 | 6 | - | - |
brarr_pan_p017699 | orthology | 0.983 | 8 | 105 | 2.56e-29 |
brarr_pan_p042391 | orthology | 0.966 | 6 | - | - |
maldo_pan_p037558 | orthology | 0.494 | 5 | - | - |
maldo_pan_p044634 | orthology | 0.493 | 5 | - | - |
maldo_pan_p046030 | orthology | 0.443 | 5 | 216 | 5.09e-72 |
maldo_pan_p049521 | orthology | 0.493 | 5 | - | - |
maldo_pan_p049537 | orthology | 0.452 | 5 | - | - |
maldo_pan_p055366 | orthology | 0.494 | 5 | - | - |