Gene Cs9g03680.1
| Sequence ID | Cs9g03680.1 add to my list | ||
|---|---|---|---|
| Species | Citrus sinensis | ||
| Alias | No gene alias | ||
| Length | 336aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 336 amino acids
>Cs9g03680.1_CITSI MAPELEKPRVTEIQVRMDCNGCVQKIKKALHGINGIYDLHIDFPQQKLTIVGWADPERIV KAIRKTRKIATISSHSEQTEPSNQPTEQALPEDGAPAPSNDAPANPPPPEGPPAEQPQPA EPPKVPPPTENPAPPENPPPPEDPQPEVKPSPIAADANANQQACPSRAKDIGEVHVIHHH PPDYGYRYSYGYGNNYSGHWNRYPSAARNQHEAPQGPQPVYNQYGEPQGPKPVYNQHGEP QGPQPVYNQHGAPQGPQPVYVTHSYNTYKPPPYVTEYEYLRSPPRHTHYSRMDHYSDDYH NNYHNNNVYYNTSNGSGNGNITSIFSDENPNACTVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs9g03680.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_4g18950.1 | orthology | 0.578 | 4 | 149.1 | 5.1e-36 |
| Manes.15G008800.1 | orthology | 0.428 | 1 | 174.1 | 1.7e-43 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04327.1 | orthology | 0.853 | 5 | 117.9 | 1.4e-26 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_31773.1 | orthology | 0.714 | 6 | 138 | 4.76e-39 |
| cicar_pan_p002360 | orthology | 0.929 | 6 | 117 | 6.14e-31 |
| maldo_pan_p004517 | orthology | 0.588 | 4 | 239 | 1.3e-76 |
| maldo_pan_p022412 | orthology | 0.607 | 4 | - | - |
| medtr_pan_p024125 | orthology | 0.953 | 6 | 105 | 1.98e-26 |
| phavu.G19833.gnm2.ann1.Phvul.003G108900.1 | orthology | 0.927 | 6 | 114.4 | 1.4e-25 |
| soybn_pan_p005812 | orthology | 0.851 | 5 | - | - |
| soybn_pan_p009634 | orthology | 0.884 | 6 | - | - |
| soybn_pan_p012740 | orthology | 0.685 | 6 | 151 | 5.84e-44 |
| thecc_pan_p016610 | orthology | 0.455 | 2 | 222 | 4.08e-70 |
| vitvi_pan_p020280 | orthology | 0.441 | 4 | 236 | 2.05e-76 |