Gene DCAR_006348


Sequence ID DCAR_006348  add to my list
Species Daucus carota
Alias No gene alias
Length 85aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 85 amino acids

>DCAR_006348_DAUCA
MAETVVLKVGMSCQGCVGAVKRVLGKMEGVESFDIDIDQQKVTVKGNVQPDAVFQTVAKT
GKKTEYWDSAAGAAESKPTETVAVA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for DCAR_006348