Gene DCAR_007285


Sequence ID DCAR_007285  add to my list
Species Daucus carota
Alias No gene alias
Length 144aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 144 amino acids

>DCAR_007285_DAUCA
MGVLDHFSDLCSTSSTRKSKRKPMQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVDVIRK
QSRLTVTGYVEPNKVLKKVQSTGKRAEFWPYVPYNLVAQPYAPQAYDKKAPPGYVKKVVQ
SPNAPVERYTTIFSDDNPNACSVM





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397
Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for DCAR_007285



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AUR62014197-RA orthology 0.464 4 208.4 5.2e-54
AUR62024872-RA orthology 0.633 5 - -
AUR62030676-RA orthology 0.605 5 - -
Bv2_043150_njdu.t1 orthology 0.563 4 203.4 9.1e-53
Bv6_142690_rfcx.t1 orthology 0.821 5 - -
Ca_9_830.1 orthology 0.376 3 - -
Cc11_g08870 orthology 0.376 3 217.2 6e-57
DCAR_023613 ultra-paralogy 0.217 0 - -
DCAR_026769 ultra-paralogy 0.187 0 - -
HanXRQChr08g0212651 orthology 0.415 3 225.7 3e-59
Oeu036720.1 orthology 0.415 5 - -
Oeu044351.1 orthology 0.398 5 223.8 1.1e-58
PGSC0003DMP400010633 orthology 0.475 8 218.8 2.4e-57
Solyc04g007630.1.1 orthology 0.469 8 219.2 1.8e-57
capan_pan_p011898 orthology 0.475 7 228 3.73e-78
capan_pan_p025493 orthology 0.416 7 - -
capan_pan_p030603 orthology 0.485 7 - -
ipotf_pan_p001332 orthology 0.696 7 - -
ipotf_pan_p026205 orthology 0.701 7 - -
ipotf_pan_p028506 orthology 0.558 7 - -
itb04g14310.t1 orthology 0.675 7 - -
itb07g07120.t1 orthology 0.55 7 - -
itb14g01060.t2 orthology 0.701 7 - -