Gene DCAR_011873
| Sequence ID | DCAR_011873 add to my list |
|---|---|
| Species | Daucus carota |
| Alias | No gene alias |
| Length | 77aa |
Length: 77 amino acids
>DCAR_011873_DAUCA MPIMQVLIISILGALMATEFSGSSLIGTVPWLKYLVIGDEAPLRVIQDTVQLLGVTATIP CITLILGGNLAQGKLVT
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
| 2 | GP015273 | Unannotated cluster |
| 3 | GP040583 | Unannotated cluster |
| 4 | GP463648 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.