Gene DCAR_014247
Sequence ID | DCAR_014247 add to my list | ||
---|---|---|---|
Species | Daucus carota | ||
Alias | No gene alias | ||
Length | 151aa | ||
Gene Ontology |
![]()
|
Length: 151 amino acids
>DCAR_014247_DAUCA MGVNGTLEYISDMMSSGHRHKKRKQMQTVDLKVRMDCDGCELKVKKALSSLSGVKSVEIN RKQQKVTVNGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYSAQAYDKKAPAGYVRKV ENTAASGTVTTYEDPYMNMFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.