Gene DCAR_016078
Sequence ID | DCAR_016078 add to my list | ||
---|---|---|---|
Species | Daucus carota | ||
Alias | No gene alias | ||
Length | 145aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 145 amino acids
>DCAR_016078_DAUCA MGKLRFGKMLDRLCLSSSYGTSCCICINGYGSSFDGVDDLEKEPLVGTEGDELVRLKDFV EEPKSLALQLKPKIVVLRVSMHCNGCARKVEKHISKMDGVTSYQIDLETKMVVIMGDIVP FEVVESIAKVKNAEFWQSPSVDHKT
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for DCAR_016078
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
DCAR_031728 | orthology | 0 | 1 | - | - |
ipotf_pan_p015062 | orthology | 0.529 | 3 | 182 | 5.52e-60 |
itb08g06620.t1 | orthology | 0.524 | 3 | 184.1 | 7.2e-47 |