Gene DCAR_021816
| Sequence ID | DCAR_021816 add to my list | ||
|---|---|---|---|
| Species | Daucus carota | ||
| Alias | No gene alias | ||
| Length | 258aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 258 amino acids
>DCAR_021816_DAUCA MAKEGDIKKVELNVSVHCCDGCKKKVKKILRKTEGVLNVEIDTVEPKVTVLGNVEPQKLI KKLLKVGKQAEIWSYNDQNATKENKESRMPPSKKSDTEFSAPGGEQMNHAETQRATSPDK HTESAVSKEGAGNKGLDHKDINHGAAGMLRTVNPLLHQPEASGVLIHPSIATHDGARRVI SPDTLTQQYYYMVEPPRGPVIMPYYAVYPYNAAPVYTRGPELQNYGQIMMEPPVQAPAST TVLGDYFNDENTVGCQIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for DCAR_021816
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg2g009290.1 | orthology | 1 | 5 | 150.6 | 1.3e-36 |
| Cm129350.1 | orthology | 1 | 5 | 151 | 1.7e-36 |
| Cs2g14960.1 | orthology | 1 | 4 | - | - |
| Manes.04G096100.1 | orthology | 0.972 | 4 | 138.7 | 6.1e-33 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_40153.1 | orthology | 1 | 3 | 136 | 3.9e-32 |
| soybn_pan_p004695 | orthology | 1 | 3 | - | - |
| soybn_pan_p009525 | orthology | 1 | 3 | 112 | 5.16e-30 |
| thecc_pan_p023830 | orthology | 1 | 4 | 115 | 8.27e-31 |
| vitvi_pan_p003003 | orthology | 0.937 | 4 | 147 | 2.53e-43 |