Gene DCAR_029550
Sequence ID | DCAR_029550 add to my list | ||
---|---|---|---|
Species | Daucus carota | ||
Alias | No gene alias | ||
Length | 233aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 233 amino acids
>DCAR_029550_DAUCA MGKEEKKEKGNPVVVAGYKVHLHCPQCAEDIRKPLLRTTGVHSVDVKYEKNEVIIKGAID EKMIHTKLEKWSRKQVEILAKDKINIVQVKDKETKSETVKTTTIKSYIHCDQCERDLRNR LIKHQGIHDVKTDRKAHTITVVGIIESEKLLTYMRKKVHKHAEIITSKKEKKDGKKETIE AELKSTETTKLVEFQEEIKVEAKVKDGNVPYFVHYVYAPQMFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for DCAR_029550
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_46_563.1 | orthology | 0.521 | 3 | - | - |
Ca_64_447.2 | orthology | 0.517 | 4 | 231.1 | 1.9e-60 |
Cc02_g26130 | orthology | 0.517 | 4 | 248.1 | 5.1e-66 |
HanXRQChr06g0168381 | orthology | 0.652 | 2 | 192.6 | 4.5e-49 |
Oeu036922.1 | orthology | 0.5 | 3 | - | - |
PGSC0003DMP400011529 | orthology | 0.661 | 5 | 211.1 | 8.1e-55 |
Solyc10g039390.1.1 | orthology | 0.714 | 5 | 219.9 | 1.7e-57 |
capan_pan_p023451 | orthology | 0.688 | 4 | 141 | 6.65e-43 |
ipotf_pan_p011107 | orthology | 0.62 | 4 | 240 | 3.65e-80 |
itb09g19040.t1 | orthology | 0.643 | 4 | 159.5 | 3.1e-39 |