Gene DCAR_030843
| Sequence ID | DCAR_030843 add to my list | ||
|---|---|---|---|
| Species | Daucus carota | ||
| Alias | No gene alias | ||
| Length | 276aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 276 amino acids
>DCAR_030843_DAUCA MGEEKKEEEKREEEKKEEASGGGGDKKQQEEKKEEEEEPLVLKVDMHCEACARKVKRSLK GFQGVEQVTADCKASKVVVKGKTADPIKVCERIQKKSGRKVEIISPLPKPPEENKVQEAK QEEPPNEEKKDEPPPVVTVVLKIGMHCEACAQVLQKRIRKIKGVESVMIDLANDRVTVKG VLDPEKLVVDVYKKTKKQAIVLKDEEKKEEGKKEEEKKEDNEATKKEVEEAKEDDQDNKG MDIMKNEYYGPKSYTEYSTYVPQMFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for DCAR_030843
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.508 | 5 | - | - |
| Ca_32_762.1 | orthology | 0.572 | 5 | - | - |
| Ca_69_1.19 | orthology | 0.572 | 5 | - | - |
| Ca_78_26.1 | orthology | 0.508 | 5 | - | - |
| Ca_9_645.2 | orthology | 0.567 | 4 | - | - |
| Cc09_g00430 | orthology | 0.567 | 5 | - | - |
| Cg2g046420.1 | orthology | 0.587 | 9 | - | - |
| Cm145580.1 | orthology | 0.804 | 8 | - | - |
| Cm298860.1 | orthology | 0.593 | 8 | - | - |
| Cs2g01750.1 | orthology | 0.587 | 9 | - | - |
| DCAR_002239 | ultra-paralogy | 0.242 | 0 | - | - |
| FvH4_3g00420.1 | orthology | 0.551 | 9 | - | - |
| HanXRQChr16g0515801 | orthology | 0.484 | 1 | - | - |
| MELO3C008010.2.1 | orthology | 0.694 | 8 | 185.7 | 3.5e-47 |
| Manes.09G082500.1 | orthology | 0.741 | 8 | 196 | 4.39e-62 |
| Manes.S022000.1 | orthology | 0.514 | 8 | - | - |
| Oeu029318.1 | orthology | 0.349 | 2 | - | - |
| Oeu057024.1 | orthology | 0.387 | 2 | - | - |
| PGSC0003DMP400023518 | orthology | 0.72 | 7 | - | - |
| PGSC0003DMP400026383 | orthology | 0.485 | 6 | 208.4 | 6.2e-54 |
| Solyc04g015030.2.1 | orthology | 0.493 | 6 | 214.9 | 6.6e-56 |
| Solyc11g012690.1.1 | orthology | 0.769 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.562 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.499 | 7 | - | - |
| capan_pan_p012494 | orthology | 0.622 | 5 | - | - |
| capan_pan_p018045 | orthology | 0.735 | 6 | - | - |
| cicar_pan_p024449 | orthology | 0.519 | 6 | - | - |
| cucsa_pan_p011686 | orthology | 0.682 | 8 | 221 | 1.83e-71 |
| ipotf_pan_p000797 | orthology | 0.507 | 6 | - | - |
| itb01g10210.t2 | orthology | 0.513 | 6 | - | - |
| maldo_pan_p012376 | orthology | 0.564 | 9 | - | - |
| maldo_pan_p020510 | orthology | 0.573 | 9 | - | - |
| medtr_pan_p010658 | orthology | 0.505 | 6 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.513 | 7 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.55 | 7 | 192.2 | 4.4e-49 |
| soybn_pan_p008938 | orthology | 0.494 | 6 | - | - |
| soybn_pan_p009673 | orthology | 0.526 | 6 | - | - |
| soybn_pan_p024238 | orthology | 0.507 | 6 | - | - |
| thecc_pan_p018912 | orthology | 0.482 | 8 | - | - |
| vitvi_pan_p012828 | orthology | 0.542 | 7 | 239 | 1.07e-78 |