Gene Dr15258
| Sequence ID | Dr15258 add to my list | ||
|---|---|---|---|
| Species | Dioscorea rotundata | ||
| Alias | No gene alias | ||
| Length | 189aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 189 amino acids
>Dr15258_DIORT MSAQHLDILMSINAQSSSCQPTLNFVIAILFPRQTVREMGAFDYLSNICSVTNTKRTLKL KKRKPLQTVELKVKMDCDGCERRVRHAVRSIKGVTAVEVNRKQSKVAVTGHVDTKKVIKK VRSIGKRAEPWPYVEYNLVYYPYAAQAYDKKAPTGYVRNVPQALPNPGAPEERYTTLFSD ENVNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Dr15258
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba01_g16120.1 | orthology | 0.538 | 3 | 227.3 | 9.3e-60 |
| Mba02_g09520.1 | orthology | 0.505 | 3 | - | - |
| XP_008811964.1 | orthology | 0.318 | 2 | 243.4 | 1.8e-64 |
| XP_010916340.1 | orthology | 0.341 | 3 | 240.7 | 1.3e-63 |
| cocnu_pan_p017926 | orthology | 0.361 | 3 | 232 | 4.78e-79 |
| musac_pan_p009592 | orthology | 0.525 | 3 | - | - |
| musac_pan_p028185 | orthology | 0.485 | 3 | 228 | 2.61e-77 |