Gene FvH4_3g07830.1
| Sequence ID | FvH4_3g07830.1 add to my list | ||
|---|---|---|---|
| Species | Fragaria vesca | ||
| Alias | No gene alias | ||
| Length | 170aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 170 amino acids
>FvH4_3g07830.1_FRAVE MTIVEMQVHMDCSGCENKIKKALKKIKGVDDIDVDINMQKVTVMGWAKQEKVLKAVRRTG RTAELWPYPYNPEYGHNLNVQYYQQHQPRDGHEHHHHHHNHHDRGEHRSKHNITTYNSIP NYSSYSYNYYKHGYSGMEHGYYQPPPYSTMFSEQDTAVFSDDNPNSCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP542154 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_3g07830.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg7g011400.1 | orthology | 0.745 | 6 | 145.2 | 3.6e-35 |
| Cm129650.1 | orthology | 0.77 | 6 | 138.3 | 7.3e-33 |
| Manes.17G055500.1 | orthology | 0.713 | 5 | 154.8 | 5.4e-38 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_31664.1 | orthology | 0.722 | 6 | - | - |
| cicar_pan_p021456 | orthology | 0.84 | 6 | - | - |
| maldo_pan_p003465 | orthology | 0.404 | 1 | - | - |
| maldo_pan_p053909 | orthology | 0.365 | 1 | 236 | 1.89e-80 |
| soybn_pan_p018217 | orthology | 0.683 | 5 | 153 | 2.29e-48 |
| thecc_pan_p000996 | orthology | 0.589 | 2 | 174 | 1.04e-56 |