Gene FvH4_3g29750.1
| Sequence ID | FvH4_3g29750.1 add to my list | ||
|---|---|---|---|
| Species | Fragaria vesca | ||
| Alias | No gene alias | ||
| Length | 131aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 131 amino acids
>FvH4_3g29750.1_FRAVE MGKKNKNEQEEAKVVVAEFKVSMHCNACERIVAKTLLKIKGVEKFGTDMNNHKVVVTGKI DPEKILKKLRKKTGKRVEIIDDKEEEQNAESDEGNLSRPLIVHPLMFDCCKESDQLLLMF SDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP345758 | Unannotated cluster |
| 4 | GP467256 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_3g29750.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 1 | 7 | 111.7 | 3.5e-25 |
| Ca_27_985.2 | orthology | 1 | 8 | - | - |
| Ca_34_139.2 | orthology | 1 | 8 | - | - |
| Ca_43_446.2 | orthology | 1 | 7 | - | - |
| Cc03_g02440 | orthology | 1 | 7 | 97.1 | 8.2e-21 |
| Cg9g003840.1 | orthology | 0.696 | 4 | 114.8 | 4e-26 |
| Cm135610.1 | orthology | 0.728 | 4 | 134.8 | 6.2e-32 |
| Cs9g05250.1 | orthology | 0.611 | 3 | 126.3 | 1.4e-29 |
| DCAR_030575 | orthology | 1 | 6 | 103.6 | 1.1e-22 |
| FvH4_4g16960.1 | ultra-paralogy | 0.0947 | 0 | - | - |
| HanXRQChr08g0226491 | orthology | 1 | 6 | 122.9 | 2.4e-28 |
| MELO3C021374.2.1 | orthology | 0.699 | 2 | - | - |
| Manes.15G018700.1 | orthology | 0.841 | 5 | 116.3 | 1.6e-26 |
| Solyc03g098650.2.1 | orthology | 1 | 6 | 119.4 | 1.8e-27 |
| brana_pan_p026722 | orthology | 1 | 9 | 103 | 2.34e-29 |
| braol_pan_p034893 | orthology | 1 | 8 | 105 | 5.26e-30 |
| braol_pan_p054032 | orthology | 1 | 7 | - | - |
| brarr_pan_p010495 | orthology | 1 | 9 | 102 | 1.08e-28 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 0.798 | 5 | 146.4 | 1.5e-35 |
| cicar_pan_p022803 | orthology | 0.764 | 5 | 129 | 3.1e-40 |
| cucsa_pan_p017292 | orthology | 0.734 | 2 | - | - |
| medtr_pan_p033077 | orthology | 0.802 | 5 | 134 | 1.19e-41 |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 0.867 | 6 | 138.7 | 2.7e-33 |
| soybn_pan_p008694 | orthology | 0.806 | 6 | - | - |
| soybn_pan_p032351 | orthology | 0.84 | 6 | - | - |
| thecc_pan_p001371 | orthology | 0.64 | 4 | 146 | 1.22e-46 |
| vitvi_pan_p022438 | orthology | 0.89 | 4 | 112 | 3.44e-33 |
| vitvi_pan_p032656 | orthology | 0.881 | 4 | - | - |