Gene FvH4_5g08650.1
Sequence ID | FvH4_5g08650.1 add to my list | ||
---|---|---|---|
Species | Fragaria vesca | ||
Alias | No gene alias | ||
Length | 348aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 348 amino acids
>FvH4_5g08650.1_FRAVE MGEKEKKPEEKKMEEKKPEEVKKPEEEKKAEENKKEEKPAEEKKEEKKAEEGKDGKEAKE GDAPPPPPPPQEIVLRVYMHCEGCARKVKRCLKGFQGVEDVSTDCKSHKVVVKGEKADPI KVLERVQRKSHRQVELLSPIPKPPAEEEKKPEEKPKPEEKKEEPPQVISVVLKVHMHCEA CAQEIKKRIQRMKGVESAEPDLKGSQVTVKGVFDPAKLVEYVYKRTGKQAEIVKQEPEKK ADKEEAKEGSKDGKKGGEEGGKDKKSGDGGGEAAPPAEDNKEKKGDGNEGGAAASVAPEG GAVTEETKVGELMKINEYNYYPPRYAMELYAYPPQIFSDENPNACAVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_5g08650.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg7g010440.1 | orthology | 0.371 | 6 | 221.9 | 6.1e-58 |
Cm018610.1 | orthology | 0.373 | 6 | 221.9 | 1e-57 |
Manes.06G121400.1 | orthology | 0.294 | 4 | 259.6 | 3.2e-69 |
Manes.14G049200.1 | orthology | 0.308 | 4 | 294 | 2.35e-98 |
maldo_pan_p003643 | orthology | 0.159 | 1 | - | - |
maldo_pan_p029843 | orthology | 0.16 | 1 | 303 | 9.88e-102 |
orange1.1t02606.2 | orthology | 0.378 | 5 | 224.9 | 7.9e-59 |
thecc_pan_p013659 | orthology | 0.306 | 3 | 284 | 3.4e-94 |
vitvi_pan_p029254 | orthology | 0.337 | 3 | 302 | 1.39e-101 |