Gene FvH4_6g16410.1
Sequence ID | FvH4_6g16410.1 add to my list | ||
---|---|---|---|
Species | Fragaria vesca | ||
Alias | No gene alias | ||
Length | 347aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 347 amino acids
>FvH4_6g16410.1_FRAVE MGEKVEGAKNEGEKKAADAGKKVDDGSNTVVYKTDMHCEGCAKKIKRAVKNFPGVEQVKT DAGANKLTVTGKMDPAALKARLEEKIKKKVDLVSPQPAKKEGGGGGGDKKADEKSEKPSE KKAEEKKPADKKPIEKEAAAPKESTVPLKIRLHCEGCIQKMRSKILKYKGVSTVSFDMAK DLVTVVGTMDTKTLVPYLSEKFKRPVDVIAPAKKDDGAGAKKDDKKPAAEGGEKKDGGGD KKEEKKEGKKEAAPAGEKKEEKKEAAAGGGGGGAVVNKMEYSGYPYAASTSYWYDPGHVY NHNKFVMEAQEHQAHVNQGYGHYAMPMEHYPAPQMFSDENPNGCSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_6g16410.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
CgUng002500.1 | orthology | 0.567 | 7 | 211.8 | 6.3e-55 |
CgUng019980.1 | orthology | 0.567 | 7 | - | - |
Cm060230.1 | orthology | 0.569 | 5 | 206.8 | 3.4e-53 |
MELO3C024466.2.1 | orthology | 0.624 | 3 | 180.3 | 1.8e-45 |
Manes.08G010600.1 | orthology | 0.667 | 4 | 177.6 | 1.6e-44 |
Manes.09G066300.1 | orthology | 0.694 | 4 | - | - |
cucsa_pan_p001888 | orthology | 0.635 | 3 | 214 | 5.18e-67 |
maldo_pan_p018618 | orthology | 0.357 | 1 | 332 | 1.38e-112 |
maldo_pan_p021518 | orthology | 0.371 | 1 | - | - |
orange1.1t00956.1 | orthology | 0.569 | 6 | 202.6 | 4.2e-52 |