Gene FvH4_6g16410.1


Sequence ID FvH4_6g16410.1  add to my list
Species Fragaria vesca
Alias No gene alias
Length 347aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 347 amino acids

>FvH4_6g16410.1_FRAVE
MGEKVEGAKNEGEKKAADAGKKVDDGSNTVVYKTDMHCEGCAKKIKRAVKNFPGVEQVKT
DAGANKLTVTGKMDPAALKARLEEKIKKKVDLVSPQPAKKEGGGGGGDKKADEKSEKPSE
KKAEEKKPADKKPIEKEAAAPKESTVPLKIRLHCEGCIQKMRSKILKYKGVSTVSFDMAK
DLVTVVGTMDTKTLVPYLSEKFKRPVDVIAPAKKDDGAGAKKDDKKPAAEGGEKKDGGGD
KKEEKKEGKKEAAPAGEKKEEKKEAAAGGGGGGAVVNKMEYSGYPYAASTSYWYDPGHVY
NHNKFVMEAQEHQAHVNQGYGHYAMPMEHYPAPQMFSDENPNGCSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP071484 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for FvH4_6g16410.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
CgUng002500.1 orthology 0.567 7 211.8 6.3e-55
CgUng019980.1 orthology 0.567 7 - -
Cm060230.1 orthology 0.569 5 206.8 3.4e-53
MELO3C024466.2.1 orthology 0.624 3 180.3 1.8e-45
Manes.08G010600.1 orthology 0.667 4 177.6 1.6e-44
Manes.09G066300.1 orthology 0.694 4 - -
cucsa_pan_p001888 orthology 0.635 3 214 5.18e-67
maldo_pan_p018618 orthology 0.357 1 332 1.38e-112
maldo_pan_p021518 orthology 0.371 1 - -
orange1.1t00956.1 orthology 0.569 6 202.6 4.2e-52