Gene FvH4_7g05820.1


Sequence ID FvH4_7g05820.1  add to my list
Species Fragaria vesca
Alias No gene alias
Length 87aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 87 amino acids

>FvH4_7g05820.1_FRAVE
MASQTTVLKVGMSCQGCVGAVKRVLGKLEGVESYDIDFDAQKVTVKGNVPAETVLQTVSK
TGKKTAYWEAEAPAEPEAKPAEAVAAA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for FvH4_7g05820.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C012358.2.1 orthology 0.342 3 85.1 2e-17
cucsa_pan_p012118 orthology 0.32 3 111 7.15e-34
maldo_pan_p006752 orthology 0.0451 1 142 3.68e-46
maldo_pan_p024825 orthology 0.0591 1 - -