Gene HORVU1Hr1G080800.1
Sequence ID | HORVU1Hr1G080800.1 add to my list | ||
---|---|---|---|
Species | Hordeum vulgare | ||
Alias | No gene alias | ||
Length | 152aa | ||
Gene Ontology |
![]()
|
Length: 152 amino acids
>HORVU1Hr1G080800.1_HORVU MAMKRRLWRRMGGSVLGCFAACVGAGAGAGCGCLCARALEEVVEERKALVSGSSQVVRLT DLLVGKGSSSSSSTTLGFHLQPKTVELRVSMHCYGCAKKVHKHISKMEGVTWFEVDLERK KVVVTGDVTPLEVLQSVSKVKLAQLWMPPQPC
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HORVU1Hr1G080800.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
tritu_pan_p020486 | orthology | 0.112 | 1 | - | - |
tritu_pan_p038217 | orthology | 0.12 | 1 | 235 | 1.06e-80 |