Gene HORVU2Hr1G011060.1
| Sequence ID | HORVU2Hr1G011060.1 add to my list | ||
|---|---|---|---|
| Species | Hordeum vulgare | ||
| Alias | No gene alias | ||
| Length | 155aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 155 amino acids
>HORVU2Hr1G011060.1_HORVU MGIVDVVSEYCSLPRTRRHMKKRKQFQTVEMKVRIDCEGCERKVKKALDDMKXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXSTEARYTAAFSDENPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HORVU2Hr1G011060.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba04_g22800.1 | orthology | 0.427 | 5 | - | - |
| Mba04_g33020.1 | orthology | 0.467 | 5 | - | - |
| ORGLA04G0039000.1 | orthology | 0.0773 | 4 | - | - |
| bradi_pan_p006044 | orthology | 0.0655 | 2 | - | - |
| musac_pan_p005239 | orthology | 0.467 | 5 | - | - |
| musac_pan_p034720 | orthology | 0.468 | 5 | - | - |
| orysa_pan_p007886 | orthology | 0.0773 | 4 | - | - |
| tritu_pan_p002673 | orthology | 0.0293 | 1 | - | - |