Gene HORVU2Hr1G123310.1
| Sequence ID | HORVU2Hr1G123310.1 add to my list |
|---|---|
| Species | Hordeum vulgare |
| Alias | No gene alias |
| Length | 106aa |
Length: 106 amino acids
>HORVU2Hr1G123310.1_HORVU SPSSLPVALSPSSRPLLGFDAFASSRPVAMATKCIIGALIGSLGVAYVSDTIVSDKKIFG GTVCKTATDKEWFQATDAKFQAWPRTAGPPVIMNPISRQNFIVKNP
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for HORVU2Hr1G123310.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr18262 | orthology | 0.833 | 2 | - | - |
| HORVU7Hr1G008110.2 | ultra-paralogy | 0.192 | 0 | - | - |
| tritu_pan_p020571 | orthology | 0.201 | 1 | - | - |
| tritu_pan_p047458 | orthology | 0.354 | 1 | - | - |