Gene HORVU3Hr1G072940.2
Sequence ID | HORVU3Hr1G072940.2 add to my list | ||
---|---|---|---|
Species | Hordeum vulgare | ||
Alias | No gene alias | ||
Length | 157aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 157 amino acids
>HORVU3Hr1G072940.2_HORVU MLPWSITCQIVEMCVHMCCAGCEKKIRKAVEKLEGVHAVEIDMEMQKVTVSGDVDQKKVL KTVRRTGKRAVLWPTPFIAGAGAGAGGAVNLLAQQHQYHPGGAQMYATHASGSTSSYNYY KHGYDDSRLYGANSAVVGGTRATDYFSDENTGGCSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HORVU3Hr1G072940.2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba03_g16740.1 | orthology | 0.527 | 4 | - | - |
XP_008813766.1 | orthology | 0.639 | 5 | 151.4 | 7.9e-37 |
XP_010920018.1 | orthology | 0.651 | 6 | 148.7 | 5.5e-36 |
bradi_pan_p002062 | orthology | 0.21 | 2 | 216 | 3.02e-73 |
cocnu_pan_p020915 | orthology | 0.659 | 6 | - | - |
musac_pan_p001588 | orthology | 0.547 | 4 | 158 | 1.93e-50 |
tritu_pan_p029517 | orthology | 0.0455 | 1 | 282 | 3.27e-99 |