Gene HORVU3Hr1G080640.13


Sequence ID HORVU3Hr1G080640.13  add to my list
Species Hordeum vulgare
Alias F2CZK2, G8CMT6
Length 432aa
PubMed References
Open Display PubMed Reference(s) (3)
Accession Description
Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
21415278 		Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
Multigenic phylogeny and analysis of tree incongruences in Triticeae (Poaceae).
21702931 		Multigenic phylogeny and analysis of tree incongruences in Triticeae (Poaceae).
A physical, genetic and functional sequence assembly of the barley genome.
23075845 		A physical, genetic and functional sequence assembly of the barley genome.



Length: 432 amino acids

>HORVU3Hr1G080640.13_HORVU
MMERRSLMEALVTAAQGGSTDTSVLSMLKYAVLPIAKVFTVCFMGFLMATKYVNILQPNG
RKLLNGLVFSLLLPCLIFSQLGSAITLEKLVQWWYIPVNIVVGAVSGSLIGFVVASIIRP
PYPYFKFTVIHIGIGNIGNIPLVLIAALCRDPSNPFGDSEKCSQDGNAYISFGQWVGAII
VYTYVFKMLSPPPGETFDGEGEKLPVLASEENAMPELGKYPTGTHTSTVPEEEPLLAVEG
NQKGTTSLGSKVLSCVRCVVKFLKDKQLLQPPIIASVFAIGIGVVPVLKGLIFTDDAPLF
FFTDSCLILGEAMIPCILLAVGGNLVDGPGEGSKRLGVRTTVAIIFARLILVPIAGVGIV
MLVDKLGFIPKDDKMFKFVLLLQHSMPTSVLSGAVANLRGCGKESAAILFWVHIFAVFSM
AGWIIFYLTLLF




Clustering Level Family ID Family Name
1
Auxin efflux carrier family
GP000355		 Auxin efflux carrier family
2 GP015273 Unannotated cluster
3 GP040583 Unannotated cluster
4 GP132349 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Membrane transport protein
IPR004776 		Membrane transport protein Family
Protein PIN-LIKES 2/6
IPR039305 		Protein PIN-LIKES 2/6 Family

IPR004776 IPR039305
Figure 1: IPR domains for HORVU3Hr1G080640.13



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
tritu_pan_p029988 orthology 0.0116 1 833 5.37e-308