Gene HORVU3Hr1G106080.1
Sequence ID | HORVU3Hr1G106080.1 add to my list | ||
---|---|---|---|
Species | Hordeum vulgare | ||
Alias | No gene alias | ||
Length | 299aa | ||
Gene Ontology |
![]()
|
Length: 299 amino acids
>HORVU3Hr1G106080.1_HORVU MPANQVTIKGTVDPQALCARLRAKTKRHATLISPLPPPPPPEGEEPAPPLVTEARTVELL VNMHCEACAQQLQTKMMRMKGVVSAETDLAASRLTLSATVDDDKIVQYIHRRTGKIASVV PPPPPPEPPKEEDPHPPAAAADADQPPKEEAPAVDGEKKEDGPAAAEAGEEKKEGEEDQK PGKQEGVAVEGFPPEEMMKRMMYWPYGGGIHYKMHPADAEEAMMARRMAMHAMPPPLPPP PHHHHHNPYAMMHQQQHQWAPPPPPPPPMYSNYNYGNSYMMERPPQMFNDENPNACVIS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HORVU3Hr1G106080.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU5Hr1G062690.1 | ultra-paralogy | 0.0546 | 0 | - | - |
HORVU5Hr1G124450.1 | ultra-paralogy | 0.0334 | 0 | - | - |
tritu_pan_p005801 | orthology | 0.139 | 1 | - | - |
tritu_pan_p008304 | orthology | 0.128 | 1 | - | - |
tritu_pan_p044279 | orthology | 0.109 | 1 | - | - |