Gene HORVU6Hr1G093200.2
Sequence ID | HORVU6Hr1G093200.2 add to my list |
---|---|
Species | Hordeum vulgare |
Alias | No gene alias |
Length | 79aa |
Length: 79 amino acids
>HORVU6Hr1G093200.2_HORVU MARGVRAFEKLQSRKVRFLRPTDYYAEMVKTDSHLHKIKGKLLFEKKKIEEAEERKKAPE SKKRSKERTSRRGPRRRRN
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP075980 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Eukaryotic rRNA processing
IPR008610
|
Eukaryotic rRNA processing | Family |
Figure 1: IPR domains for HORVU6Hr1G093200.2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU4Hr1G078580.2 | ultra-paralogy | 0.266 | 0 | - | - |
tritu_pan_p034105 | orthology | 0.271 | 1 | - | - |
tritu_pan_p049693 | orthology | 0.297 | 1 | - | - |