Gene HORVU7Hr1G051110.3
| Sequence ID | HORVU7Hr1G051110.3 add to my list | ||
|---|---|---|---|
| Species | Hordeum vulgare | ||
| Alias | No gene alias | ||
| Length | 94aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 94 amino acids
>HORVU7Hr1G051110.3_HORVU MIGFVVCASNDQTSNKTLPLSQELLMDWCLRAGVERVEVEASIQKVVVTGYANRNKILKA LRRVGLRVELWSPRNELLSAYAAGSFAFNNYGFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HORVU7Hr1G051110.3
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 1 | 11 | 73.2 | 2.7e-13 |
| Ca_3_262.11 | orthology | 1 | 11 | - | - |
| Ca_455_136.3 | orthology | 1 | 11 | - | - |
| Ca_68_16.11 | orthology | 1 | 11 | - | - |
| Cc10_g00290 | orthology | 1 | 11 | 72.8 | 1.2e-13 |
| Cg3g025710.1 | orthology | 0.922 | 13 | 83.6 | 7e-17 |
| Cm122260.1 | orthology | 0.933 | 12 | 81.6 | 4.5e-16 |
| Cs3g27690.1 | orthology | 0.922 | 13 | 83.6 | 7.6e-17 |
| DCAR_023025 | orthology | 0.911 | 8 | 82.4 | 1.8e-16 |
| MELO3C017056.2.1 | orthology | 1 | 13 | 73.2 | 8.6e-14 |
| Manes.05G127500.1 | orthology | 0.96 | 11 | - | - |
| Manes.18G002200.1 | orthology | 0.973 | 11 | 81.6 | 3.2e-16 |
| Mba08_g25790.1 | orthology | 0.659 | 5 | 99.4 | 1.5e-21 |
| ORGLA08G0178600.1 | orthology | 0.424 | 4 | 97.8 | 4e-21 |
| Oeu013567.1 | orthology | 0.932 | 9 | 87.4 | 7.9e-18 |
| XP_010932092.1 | orthology | 0.6 | 6 | 102.1 | 3.5e-22 |
| XP_017697769.1 | orthology | 0.625 | 6 | 99.8 | 1.6e-21 |
| XP_019707878.1 | orthology | 0.638 | 7 | - | - |
| bradi_pan_p007471 | orthology | 0.321 | 2 | 110 | 3.84e-33 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 1 | 9 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 1 | 9 | 78.2 | 3.5e-15 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 1 | 8 | - | - |
| capan_pan_p037558 | orthology | 1 | 10 | 75.9 | 9.94e-20 |
| cicar_pan_p012771 | orthology | 1 | 10 | 80.5 | 1.9e-21 |
| cocnu_pan_p024788 | orthology | 0.6 | 6 | 102 | 2.31e-30 |
| cocnu_pan_p029661 | orthology | 0.664 | 7 | - | - |
| cucsa_pan_p017207 | orthology | 1 | 13 | 73.9 | 4.72e-19 |
| maldo_pan_p020708 | orthology | 0.957 | 11 | 76.6 | 9.13e-20 |
| medtr_pan_p031498 | orthology | 1 | 10 | 79.7 | 3.9e-21 |
| musac_pan_p036492 | orthology | 0.647 | 5 | 98.6 | 1.29e-28 |
| orysa_pan_p046260 | orthology | 0.4 | 4 | 98.6 | 1.8e-28 |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 1 | 8 | 73.2 | 1e-13 |
| soybn_pan_p018879 | orthology | 1 | 8 | - | - |
| soybn_pan_p037728 | orthology | 1 | 9 | - | - |
| soybn_pan_p037999 | orthology | 1 | 9 | - | - |
| soybn_pan_p041984 | orthology | 1 | 9 | 79 | 1.01e-20 |
| thecc_pan_p004256 | orthology | 0.97 | 12 | 81.6 | 4.37e-22 |
| tritu_pan_p008810 | orthology | 0.265 | 1 | 121 | 1.08e-37 |
| vitvi_pan_p014910 | orthology | 0.883 | 10 | 85.5 | 2.04e-23 |
| vitvi_pan_p031077 | orthology | 0.883 | 10 | - | - |