Gene HORVU7Hr1G090970.1


Sequence ID HORVU7Hr1G090970.1  add to my list
Species Hordeum vulgare
Alias F2D325
Length 159aa
PubMed References
Open Display PubMed Reference(s) (2)
Accession Description
Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
21415278 		Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
A physical, genetic and functional sequence assembly of the barley genome.
23075845 		A physical, genetic and functional sequence assembly of the barley genome.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 159 amino acids

>HORVU7Hr1G090970.1_HORVU
MGFLEALSGLCRAWPAPLTRGHLQKGRQLETVEMKVRIDCEGCESKIRKTLEGMDGVTGI
DVVPRENRVTVTGYVDAAKVMRRVERKTGKRVEPWPYVPYDVVAHPYAPGAYDKRAPAGY
VRDVMANPDAAPLARATSTETRYTGAFSDDNPNAACAIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HORVU7Hr1G090970.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba04_g22800.1 orthology 0.557 3 - -
Mba04_g33020.1 orthology 0.598 3 - -
musac_pan_p005239 orthology 0.598 3 - -
musac_pan_p034720 orthology 0.599 3 - -
tritu_pan_p034454 orthology 0.0677 1 301 9.27e-107