Gene HORVU7Hr1G100230.1


Sequence ID HORVU7Hr1G100230.1  add to my list
Species Hordeum vulgare
Alias No gene alias
Length 112aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 112 amino acids

>HORVU7Hr1G100230.1_HORVU
MASETVVLKVAMSCGGCSGAVKRVLTKMEGVESFDIDMEQQKVTVKGNVKPEDVFQTVSK
TGKKTAFWEAEEATPAAGAAAPEAAPAAPAPEAAPAADAAPAPEVTPANTTA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HORVU7Hr1G100230.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba06_g17710.1 orthology 0.676 3 123.6 8.6e-29
musac_pan_p007187 orthology 0.653 3 125 9.24e-39
tritu_pan_p034911 orthology 0.043 1 147 2.42e-47