Gene HanXRQChr06g0168381
Sequence ID | HanXRQChr06g0168381 add to my list | ||
---|---|---|---|
Species | Helianthus annuus | ||
Alias | No gene alias | ||
Length | 201aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 201 amino acids
>HanXRQChr06g0168381_HELAN MRTPGVHKVDVKHEKGEIRVEGTFEVKKIHERLEKWSRKKVEILSQDKKLMEKKETKKEI IKTTKIKAYMHCDKCEHDLRAKLLKHKGIHNVKTDIKSQTILVEGTIEAEKIVTYIQKRA RKHAEIIPEPLPKEKVEKKVEETVVEKKVEEKVTVTTKVVEFEEKKKVEAKGKDDEVPYF VHYVYAPQLFSDENPNACLVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HanXRQChr06g0168381
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_46_563.1 | orthology | 0.6 | 4 | - | - |
Ca_64_447.2 | orthology | 0.596 | 5 | 174.9 | 1.4e-43 |
Cc02_g26130 | orthology | 0.596 | 5 | 191.8 | 3.7e-49 |
DCAR_029550 | orthology | 0.652 | 2 | 193.7 | 1.2e-49 |
Oeu036922.1 | orthology | 0.58 | 4 | - | - |
PGSC0003DMP400011529 | orthology | 0.74 | 6 | 151 | 8.6e-37 |
Solyc10g039390.1.1 | orthology | 0.793 | 6 | 161 | 8.2e-40 |
capan_pan_p023451 | orthology | 0.767 | 5 | 147 | 1.23e-45 |
ipotf_pan_p011107 | orthology | 0.699 | 5 | 184 | 9.71e-59 |
itb09g19040.t1 | orthology | 0.722 | 5 | 90.1 | 2e-18 |