Gene HanXRQChr08g0209971
| Sequence ID | HanXRQChr08g0209971 add to my list | ||
|---|---|---|---|
| Species | Helianthus annuus | ||
| Alias | No gene alias | ||
| Length | 271aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 271 amino acids
>HanXRQChr08g0209971_HELAN MLCILDEQNKNKNNNNNNNNNNNNEEQQKSENSNVNGAEEKSNEQKSEKNNKQNAGAIVL GIYLHCQGCVETVVKSLRGFDGVEEIEPNTKDHRVTVKGKGADAVKVAERVRRKTGKHVE IISPVQKKQQPEKKPEKKPEVPKVTEVVLKMHLHCEGCAKDVKHCIHKMEGVQTVNPDME KSLVTVKGAFDPKNLVAYIGKRTGRHAEIVNSKNTNKQKDGEQKDGEQKNEKKEKDKDAK NARSAYPNVPPGLVYAPQLFSDENPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HanXRQChr08g0209971
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_73_71.2 | orthology | 0.691 | 3 | 198.4 | 1.6e-50 |
| Cc11_g17230 | orthology | 0.709 | 3 | 201.1 | 8.3e-52 |
| DCAR_003359 | orthology | 1 | 3 | 175.6 | 4.6e-44 |
| HanXRQChr01g0027281 | ultra-paralogy | 0.0632 | 0 | - | - |
| Solyc05g009440.1.1 | orthology | 0.736 | 3 | 202.6 | 3.3e-52 |
| capan_pan_p013590 | orthology | 0.791 | 3 | - | - |
| ipotf_pan_p016439 | orthology | 0.886 | 3 | 207 | 8.45e-67 |
| itb13g20500.t1 | orthology | 0.92 | 3 | 162.2 | 5.5e-40 |