Gene HanXRQChr08g0226491
| Sequence ID | HanXRQChr08g0226491 add to my list | ||
|---|---|---|---|
| Species | Helianthus annuus | ||
| Alias | No gene alias | ||
| Length | 132aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 132 amino acids
>HanXRQChr08g0226491_HELAN MCWKWYKNNLDKVVVAEFNISLYCDECEKLVAETISKIKGVEKFMTDMTRHHVVVMGKIR PEKVLKKLKKTGKRVEMILSCEYDIPDDVEPEDGDGDEFFQPAPNPLMYDYLRESTLYTI FSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HanXRQChr08g0226491
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 1 | 8 | - | - |
| Ca_27_985.2 | orthology | 1 | 5 | - | - |
| Ca_34_139.2 | orthology | 1 | 5 | - | - |
| Ca_43_446.2 | orthology | 1 | 4 | - | - |
| Cc03_g02440 | orthology | 0.996 | 4 | 104.4 | 5.1e-23 |
| Cg9g003840.1 | orthology | 1 | 7 | 82 | 2.9e-16 |
| Cm135610.1 | orthology | 1 | 7 | 89.7 | 2.3e-18 |
| Cs9g05250.1 | orthology | 1 | 6 | 86.3 | 1.7e-17 |
| DCAR_030575 | orthology | 1 | 3 | - | - |
| FvH4_3g29750.1 | orthology | 1 | 6 | 125.2 | 3.1e-29 |
| FvH4_4g16960.1 | orthology | 1 | 6 | - | - |
| MELO3C021374.2.1 | orthology | 1 | 7 | 108.6 | 2.6e-24 |
| Manes.15G018700.1 | orthology | 1 | 6 | 99.4 | 2.1e-21 |
| Solyc03g098650.2.1 | orthology | 0.951 | 1 | 113.6 | 9.9e-26 |
| brana_pan_p026722 | orthology | 1 | 10 | - | - |
| braol_pan_p034893 | orthology | 1 | 9 | - | - |
| braol_pan_p054032 | orthology | 1 | 8 | - | - |
| brarr_pan_p010495 | orthology | 1 | 10 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 1 | 8 | 111.3 | 5.2e-25 |
| cicar_pan_p022803 | orthology | 1 | 8 | 91.7 | 3.35e-25 |
| cucsa_pan_p017292 | orthology | 1 | 7 | 101 | 1e-28 |
| medtr_pan_p033077 | orthology | 1 | 8 | 95.1 | 3.56e-26 |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 1 | 9 | 106.3 | 1.5e-23 |
| soybn_pan_p008694 | orthology | 1 | 9 | 105 | 3.4e-30 |
| soybn_pan_p032351 | orthology | 1 | 9 | - | - |
| thecc_pan_p001371 | orthology | 1 | 5 | 111 | 1.19e-32 |
| vitvi_pan_p022438 | orthology | 1 | 3 | 100 | 2.5e-28 |
| vitvi_pan_p032656 | orthology | 1 | 3 | - | - |