Gene HanXRQChr09g0250511


Sequence ID HanXRQChr09g0250511  add to my list
Species Helianthus annuus
Alias No gene alias
Length 120aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 120 amino acids

>HanXRQChr09g0250511_HELAN
MSKKIEVEVNMHCEKCRTDVLKSVTKLSGIDQVSVDLEKQMLVVVGDDVDPVSVVERVKK
TGKRAKIITVGPSKKPDPPVSPICESIISGYPYPVCTDVYPVAVVYPQPCDYETGGCVIQ




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP241502 Unannotated cluster
3 GP344090 Unannotated cluster
4 GP556755 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HanXRQChr09g0250511



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_19_940.1 orthology 1 2 - -
Ca_24_338.2 orthology 1 2 - -
Ca_48_570.1 orthology 1 2 - -
Ca_67_416.1 orthology 1 2 - -
Ca_72_670.1 orthology 1 2 - -
Ca_73_14.2 orthology 1 3 - -
Ca_74_94.1 orthology 1 3 - -
Ca_81_33.3 orthology 1 3 - -
Ca_85_991.1 orthology 1 3 - -
Ca_90_4.2 orthology 1 2 - -
Ca_9_295.1 orthology 1 3 - -
Ca_9_642.2 orthology 1 3 - -
Cc02_g08260 orthology 1 3 - -
Cc04_g13830 orthology 1 3 - -
HanXRQChr16g0528781 ultra-paralogy 0.85 0 - -
maize_pan_p014797 orthology 1 3 - -
maize_pan_p023480 orthology 1 3 - -
sorbi_pan_p012760 orthology 1 3 - -
sorbi_pan_p027660 orthology 1 3 - -
tritu_pan_p007910 orthology 1 2 - -