Gene HanXRQChr12g0375901


Sequence ID HanXRQChr12g0375901  add to my list
Species Helianthus annuus
Alias No gene alias
Length 148aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 148 amino acids

>HanXRQChr12g0375901_HELAN
MGALDYLSNFCTVTSTSTRSRRKPMQTVEIKVKMDCDGCERRVKNSVKHIKGVKTVEVIR
KQSRVIVSGYVDPNHVLKRVKSTGKRAEFWPYIPYNLVSYPYVTQAYDKRAPAGYVKNVA
QAVAAPNTTDERMTYLFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HanXRQChr12g0375901



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_1_37.3 orthology 0.235 4 - -
Ca_25_217.3 orthology 0.235 4 - -
Ca_53_45.6 orthology 0.235 4 - -
Ca_74_24.3 orthology 0.235 4 - -
Cc07_g08240 orthology 0.235 4 - -
DCAR_025878 orthology 0.233 3 - -
HanXRQChr17g0543461 ultra-paralogy 0.111 0 - -
Oeu030808.1 orthology 0.233 2 - -
Oeu041969.1 orthology 0.296 2 - -
PGSC0003DMP400053293 orthology 0.336 4 - -
Solyc02g091300.2.1 orthology 0.315 4 - -
capan_pan_p020935 orthology 0.31 3 - -