Gene MELO3C003319.2.1
| Sequence ID | MELO3C003319.2.1 add to my list | ||
|---|---|---|---|
| Species | Cucumis melo | ||
| Alias | No gene alias | ||
| Length | 180aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 180 amino acids
>MELO3C003319.2.1_CUCME MSMVEVRVPNLDCEGCASKLRKALFKLKGVEEVEVEIEMQKITVRGYGLEERKVVKAIKR AGKAAEGWPFPGYSSHYTSFYKYPSSIANHYYDTYGGHNSYSYYSNSNSNSNYTTSTTTT PPSSNKHHHHHHLNLSNSNNYSSQLHTFFQTPSLYSLALSSDHAIASLFSDDNPHACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C003319.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.57 | 6 | 167.2 | 9.6e-42 |
| AUR62015981-RA | orthology | 0.381 | 3 | - | - |
| Bv3_055490_mxet.t1 | orthology | 0.414 | 3 | 187.2 | 8.4e-48 |
| Ca_8_1007.1 | orthology | 0.45 | 8 | 183.3 | 3.5e-46 |
| Cc02_g02970 | orthology | 0.45 | 8 | 179.9 | 1.3e-45 |
| Cg9g026790.1 | orthology | 0.37 | 6 | 197.6 | 6.4e-51 |
| Cm028340.1 | orthology | 0.37 | 6 | 197.6 | 1.1e-50 |
| Cs9g17280.1 | orthology | 0.37 | 6 | 197.6 | 6.9e-51 |
| DCAR_009368 | orthology | 0.529 | 10 | 181 | 7.3e-46 |
| FvH4_7g29520.1 | orthology | 0.41 | 7 | 203.4 | 1.2e-52 |
| HanXRQChr06g0183831 | orthology | 0.532 | 5 | 194.9 | 7e-50 |
| HanXRQChr09g0253621 | orthology | 0.559 | 5 | - | - |
| Manes.14G025900.1 | orthology | 0.443 | 7 | 192.6 | 2.5e-49 |
| Mba01_g04690.1 | orthology | 0.778 | 10 | 148.7 | 4e-36 |
| Oeu024220.1 | orthology | 0.425 | 7 | 191 | 9.7e-49 |
| PGSC0003DMP400025270 | orthology | 0.443 | 10 | 183.7 | 1.1e-46 |
| Solyc03g025790.2.1 | orthology | 0.433 | 10 | 182.6 | 2.4e-46 |
| brana_pan_p044950 | orthology | 0.543 | 7 | 170 | 8.39e-55 |
| braol_pan_p025375 | orthology | 0.543 | 8 | 171 | 4.03e-55 |
| brarr_pan_p005835 | orthology | 0.543 | 8 | 171 | 3.59e-55 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.419 | 8 | 196.1 | 2.2e-50 |
| capan_pan_p012989 | orthology | 0.456 | 9 | 186 | 4.37e-61 |
| cucsa_pan_p007884 | orthology | 0.034 | 1 | 262 | 6.87e-91 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.742 | 8 | 166 | 1.6e-41 |
| ipotf_pan_p019855 | orthology | 0.455 | 9 | 187 | 1.49e-61 |
| ipotf_pan_p021461 | orthology | 0.627 | 9 | - | - |
| itb03g13280.t1 | orthology | 0.455 | 9 | 183.7 | 1.2e-46 |
| itb12g25750.t1 | orthology | 0.613 | 9 | - | - |
| maldo_pan_p005834 | orthology | 0.415 | 7 | 200 | 9.68e-67 |
| maldo_pan_p046866 | orthology | 0.84 | 7 | - | - |
| medtr_pan_p031372 | orthology | 0.402 | 6 | 187 | 1.7e-61 |
| musac_pan_p029616 | orthology | 0.765 | 10 | 150 | 6.08e-47 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.417 | 8 | 190.3 | 1.1e-48 |
| soybn_pan_p030070 | orthology | 0.393 | 7 | 160 | 2.23e-51 |
| thecc_pan_p002573 | orthology | 0.39 | 7 | 204 | 1.77e-68 |
| vitvi_pan_p028565 | orthology | 0.368 | 4 | 196 | 2.16e-65 |